01
Technical specification
Lyophilized research material. For research purposes only. Not for human or animal consumption.
For research purposes only. Not for human or animal consumption.
Illustrative photo · the batch label contains identification data
Research material
CAS 946870-92-4
01
Lyophilized research material. For research purposes only. Not for human or animal consumption.
For research purposes only. Not for human or animal consumption.
02
Recommended storage: 2–8°C, away from light and moisture. The lyophilizate (powder) withstands short-term transport at ambient temperature and does not require a cold chain — therefore shipping is carried out as standard, without active or passive cooling. After reconstitution, use as recommended.
03
Each batch has a dedicated Certificate of Analysis (COA) confirming the chemical identity and purity of the material. The LOT number, manufacturing date (MFG) and expiry date (EXP) are shown on the vial label.
COA available after placing an order · shipped together with the invoice
The substance safety data sheet in the 16-section format compliant with REACH (Annex II) / GHS. Available in Polish, English and Danish.
Properties
| CAS number | 946870-92-4 |
|---|---|
| Synonyms | Long R3 IGF-1; LR3 IGF-1 |
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Molecular formula | C400H619N111O115S9 |
| Molecular weight | 9111.0 g/mol |
| Physical appearance | White lyophilized powder |
| PubChem LCSS | Laboratory Chemical Safety Summary |
| Terms | Laboratory research use only (RUO). Not for human, animal, diagnostic, or household use. |
2D structure

Source: PubChem · CID 168009904
04
Courier or InPost Parcel Locker delivery within the EU, at ambient temperature. Processing time: 24–72 business hours from payment confirmation.
05
Enter at least 2 characters to see results.
Popular
No results for your query.
Try entering a peptide name (e.g. „BPC-157”) or a category (e.g. „regeneration”).
PUREPOINT Supply provides research compounds strictly for laboratory use. Before entering the site, confirm your qualification and research intent.
Select all consents to continue.
By entering the site you accept PUREPOINT Supply's Research Disclaimer, Terms and Privacy Policy (FIRSTSTONE TRADING sp. z o.o., NIP 7831958614, KRS 0001254766).